General Information

  • ID:  hor005658
  • Uniprot ID:  Q9I9D3
  • Protein name:  C-flanking peptide of NPY
  • Gene name:  npy
  • Organism:  Ictalurus punctatus (Channel catfish) (Silurus punctatus)
  • Family:  NPY family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Ictalurus (genus), Ictaluridae (family), Siluroidei (suborder), Siluriformes (order), Characiphysae (superorder), Otophysi, Ostariophysi (subcohort), Otomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SNTDVLTPDLLFGEAEIRLQSRYDDPLMG
  • Length:  29(67-95)
  • Propeptide:  MRPRANVCVGWAACILLVVCLCVLAEGYPTKPENPGEDAPVEELAKYYSALRHYINLITRQRYGKRSNTDVLTPDLLFGEAEIRLQSRYDDPLMG
  • Signal peptide:  MRPRANVCVGWAACILLVVCLCVLAEG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  npy2r
  • Target Unid:  A0A2D0QDQ4
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9I9D3-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005658_AF2.pdbhor005658_ESM.pdb

Physical Information

Mass: 376625 Formula: C142H225N37O49S
Absent amino acids: CHKW Common amino acids: L
pI: 3.79 Basic residues: 2
Polar residues: 8 Hydrophobic residues: 9
Hydrophobicity: -38.28 Boman Index: -6002
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 94.14
Instability Index: 4676.9 Extinction Coefficient cystines: 1490
Absorbance 280nm: 53.21

Literature

  • PubMed ID:  NA
  • Title:  NA